General Information

  • ID:  hor002056
  • Uniprot ID:  Q9NDE7(32-76)
  • Protein name:  Insulin B chain
  • Gene name:  PIN
  • Organism:  Aplysia californica (California sea hare)
  • Family:  Insulin family
  • Source:  animal
  • Expression:  Expressed in the central region of the cerebral ganglia mostly within the F and C clusters.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Aplysia (genus), Aplysiidae (family), Aplysioidea (superfamily), Aplysiida (order), Tectipleura, Euthyneura, Heterobranchia (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  NFEHSCNGYMRPHPRGLCGEDLHVIISNLCSSLGGNRRFLAKYMV
  • Length:  45(32-76)
  • Propeptide:  MSKFLLQSHSANACLLTLLLTLASNLDISLANFEHSCNGYMRPHPRGLCGEDLHVIISNLCSSLGGNRRFLAKYMVKRDTENVNDKLRGILLNKKEAFSYLTKREASGSITCECCFNQCRIFELAQYCRLPDHFFSRISRTGRSNSGHAQLEDNFS
  • Signal peptide:  MSKFLLQSHSANACLLTLLLTLASNLDISLA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Involved in glucose metabolism
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9NDE7-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002056_AF2.pdbhor002056_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 587887 Formula: C220H344N68O62S5
Absent amino acids: QTW Common amino acids: GL
pI: 8.51 Basic residues: 8
Polar residues: 18 Hydrophobic residues: 12
Hydrophobicity: -26.44 Boman Index: -7846
Half-Life: 1.4 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 75.78
Instability Index: 4518 Extinction Coefficient cystines: 3105
Absorbance 280nm: 70.57

Literature

  • PubMed ID:  10479677
  • Title:  Insulin prohormone processing, distribution, and relation to metabolism in Aplysia californica.